Lineage for d1fq1a_ (1fq1 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123051Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 123052Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 123053Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)
  6. 123054Protein Kinase associated phosphatase (kap) [64049] (1 species)
  7. 123055Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)
  8. 123062Domain d1fq1a_: 1fq1 A: [59982]
    Other proteins in same PDB: d1fq1b_

Details for d1fq1a_

PDB Entry: 1fq1 (more details), 3 Å

PDB Description: crystal structure of kinase associated phosphatase (kap) in complex with phospho-cdk2

SCOP Domain Sequences for d1fq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq1a_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens)}
edeqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfct
rgelskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihs
ygglgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
ssr

SCOP Domain Coordinates for d1fq1a_:

Click to download the PDB-style file with coordinates for d1fq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1fq1a_: