![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) ![]() |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins) |
![]() | Protein Kinase associated phosphatase (kap) [64049] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries) |
![]() | Domain d1fq1a_: 1fq1 A: [59982] Other proteins in same PDB: d1fq1b_ |
PDB Entry: 1fq1 (more details), 3 Å
SCOP Domain Sequences for d1fq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fq1a_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens)} edeqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfct rgelskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihs ygglgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl ssr
Timeline for d1fq1a_: