Lineage for d1fpzf_ (1fpz F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851756Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1851757Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1851758Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 1851759Protein Kinase associated phosphatase (kap) [64049] (1 species)
  7. 1851760Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)
  8. 1851766Domain d1fpzf_: 1fpz F: [59981]
    complexed with so4

Details for d1fpzf_

PDB Entry: 1fpz (more details), 2 Å

PDB Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine
PDB Compounds: (F:) cyclin-dependent kinase inhibitor 3

SCOPe Domain Sequences for d1fpzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpzf_ c.45.1.1 (F:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]}
eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl

SCOPe Domain Coordinates for d1fpzf_:

Click to download the PDB-style file with coordinates for d1fpzf_.
(The format of our PDB-style files is described here.)

Timeline for d1fpzf_: