Lineage for d1fpzf_ (1fpz F:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70682Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 70683Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 70684Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)
  6. 70685Protein Kinase associated phosphatase (kap) [64049] (1 species)
  7. 70686Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)
  8. 70692Domain d1fpzf_: 1fpz F: [59981]

Details for d1fpzf_

PDB Entry: 1fpz (more details), 2 Å

PDB Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine

SCOP Domain Sequences for d1fpzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpzf_ c.45.1.1 (F:) Kinase associated phosphatase (kap) {Human (Homo sapiens)}
eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl

SCOP Domain Coordinates for d1fpzf_:

Click to download the PDB-style file with coordinates for d1fpzf_.
(The format of our PDB-style files is described here.)

Timeline for d1fpzf_: