![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (7 proteins) |
![]() | Protein Kinase associated phosphatase (kap) [64049] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries) |
![]() | Domain d1fpzd_: 1fpz D: [59979] |
PDB Entry: 1fpz (more details), 2 Å
SCOP Domain Sequences for d1fpzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpzd_ c.45.1.1 (D:) Kinase associated phosphatase (kap) {Human (Homo sapiens)} eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
Timeline for d1fpzd_: