SCOP 1.59: Domain d1fpzd_: 1fpz D:

Lineage for d1fpzd_ (1fpz D:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)

6. Protein Kinase associated phosphatase (kap) [64049] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)

8. Domain d1fpzd_: 1fpz D: [59979]

Details for d1fpzd_

PDB Entry: 1fpz, 2 Å

PDB Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine

SCOP Domain Sequences for d1fpzd_:

Sequence; same for both SEQRES and ATOM records:

>d1fpzd_ c.45.1.1 (D:) Kinase associated phosphatase (kap) {Human (Homo sapiens)}
eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl

Timeline for d1fpzd_:

• d1fpzd_ first appeared in SCOP 1.57
  
• d1fpzd_ appears in SCOP 1.61
  
• d1fpzd_ appears in the current release, SCOPe 2.08