Lineage for d1fpzc_ (1fpz C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833132Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 833133Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 833134Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)
  6. 833135Protein Kinase associated phosphatase (kap) [64049] (1 species)
  7. 833136Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)
  8. 833139Domain d1fpzc_: 1fpz C: [59978]

Details for d1fpzc_

PDB Entry: 1fpz (more details), 2 Å

PDB Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine
PDB Compounds: (C:) cyclin-dependent kinase inhibitor 3

SCOP Domain Sequences for d1fpzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpzc_ c.45.1.1 (C:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]}
eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl

SCOP Domain Coordinates for d1fpzc_:

Click to download the PDB-style file with coordinates for d1fpzc_.
(The format of our PDB-style files is described here.)

Timeline for d1fpzc_: