SCOP 1.57: Domain d1fpzc_: 1fpz C:

Lineage for d1fpzc_ (1fpz C:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)

6. Protein Kinase associated phosphatase (kap) [64049] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)

8. Domain d1fpzc_: 1fpz C: [59978]

Details for d1fpzc_

PDB Entry: 1fpz, 2 Å

PDB Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine

SCOP Domain Sequences for d1fpzc_:

Sequence; same for both SEQRES and ATOM records:

>d1fpzc_ c.45.1.1 (C:) Kinase associated phosphatase (kap) {Human (Homo sapiens)}
eqtpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrg
elskyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyg
glgrsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl

Timeline for d1fpzc_:

• d1fpzc_ is new in SCOP 1.57
  
• d1fpzc_ appears in SCOP 1.59
  
• d1fpzc_ appears in the current release, SCOPe 2.08