Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein Kinase associated phosphatase (kap) [64049] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries) |
Domain d1fpzb_: 1fpz B: [59977] complexed with so4 |
PDB Entry: 1fpz (more details), 2 Å
SCOPe Domain Sequences for d1fpzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpzb_ c.45.1.1 (B:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} tpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrgel skyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyggl grsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl
Timeline for d1fpzb_: