SCOP 1.71: Domain d1fpzb_: 1fpz B:

Lineage for d1fpzb_ (1fpz B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)

6. Protein Kinase associated phosphatase (kap) [64049] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)

8. Domain d1fpzb_: 1fpz B: [59977]

Details for d1fpzb_

PDB Entry: 1fpz, 2 Å

PDB Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine

SCOP Domain Sequences for d1fpzb_:

Sequence; same for both SEQRES and ATOM records:

>d1fpzb_ c.45.1.1 (B:) Kinase associated phosphatase (kap) {Human (Homo sapiens)}
tpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrgel
skyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyggl
grsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl

Timeline for d1fpzb_:

• d1fpzb_ first appeared in SCOP 1.57
  
• d1fpzb_ appears in SCOP 1.69
  
• d1fpzb_ appears in SCOP 1.73
  
• d1fpzb_ appears in the current release, SCOPe 2.08