Lineage for d1fpzb_ (1fpz B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395608Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 395609Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 395610Family c.45.1.1: Dual specificity phosphatase-like [52800] (7 proteins)
  6. 395611Protein Kinase associated phosphatase (kap) [64049] (1 species)
  7. 395612Species Human (Homo sapiens) [TaxId:9606] [64050] (2 PDB entries)
  8. 395614Domain d1fpzb_: 1fpz B: [59977]

Details for d1fpzb_

PDB Entry: 1fpz (more details), 2 Å

PDB Description: crystal structure analysis of kinase associated phosphatase (kap) with a substitution of the catalytic site cysteine (cys140) to a serine

SCOP Domain Sequences for d1fpzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpzb_ c.45.1.1 (B:) Kinase associated phosphatase (kap) {Human (Homo sapiens)}
tpihiswlslsrvncsqflglcalpgckfkdvrrnvqkdteelkscgiqdifvfctrgel
skyrvpnlldlyqqcgiithhhpiadggtpdiascceimeelttclknyrktlihsyggl
grsclvaaclllylsdtispeqaidslrdlrgsgaiqtikqynylhefrdklaahl

SCOP Domain Coordinates for d1fpzb_:

Click to download the PDB-style file with coordinates for d1fpzb_.
(The format of our PDB-style files is described here.)

Timeline for d1fpzb_: