Lineage for d1fpyj2 (1fpy J:101-468)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137346Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 137347Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 137348Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 137349Protein Glutamine synthetase, C-terminal domain [55933] (1 species)
  7. 137350Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 137386Domain d1fpyj2: 1fpy J:101-468 [59971]
    Other proteins in same PDB: d1fpya1, d1fpyb1, d1fpyc1, d1fpyd1, d1fpye1, d1fpyf1, d1fpyg1, d1fpyh1, d1fpyi1, d1fpyj1, d1fpyk1, d1fpyl1

Details for d1fpyj2

PDB Entry: 1fpy (more details), 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

SCOP Domain Sequences for d1fpyj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpyj2 d.128.1.1 (J:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOP Domain Coordinates for d1fpyj2:

Click to download the PDB-style file with coordinates for d1fpyj2.
(The format of our PDB-style files is described here.)

Timeline for d1fpyj2: