SCOP 1.61: Domain d1fpyj1: 1fpy J:1-100

Lineage for d1fpyj1 (1fpy J:1-100)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d1fpyj1: 1fpy J:1-100 [59970]
   Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2

Details for d1fpyj1

PDB Entry: 1fpy, 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

SCOP Domain Sequences for d1fpyj1:

Sequence; same for both SEQRES and ATOM records:

>d1fpyj1 d.15.9.1 (J:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Timeline for d1fpyj1:

• d1fpyj1 first appeared in SCOP 1.57
  
• d1fpyj1 appears in SCOP 1.59
  
• d1fpyj1 appears in SCOP 1.63
  
• d1fpyj1 appears in the current release, SCOPe 2.08