Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins) |
Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries) |
Domain d1fpyi2: 1fpy I:101-468 [59969] Other proteins in same PDB: d1fpya1, d1fpyb1, d1fpyc1, d1fpyd1, d1fpye1, d1fpyf1, d1fpyg1, d1fpyh1, d1fpyi1, d1fpyj1, d1fpyk1, d1fpyl1 complexed with adp, mn, ppq |
PDB Entry: 1fpy (more details), 2.89 Å
SCOPe Domain Sequences for d1fpyi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpyi2 d.128.1.1 (I:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv efelyysv
Timeline for d1fpyi2: