Lineage for d1fpyh1 (1fpy H:1-100)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131361Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 131362Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 131363Protein Glutamine synthetase, N-terminal domain [54370] (1 species)
  7. 131364Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 131398Domain d1fpyh1: 1fpy H:1-100 [59966]
    Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2

Details for d1fpyh1

PDB Entry: 1fpy (more details), 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

SCOP Domain Sequences for d1fpyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpyh1 d.15.9.1 (H:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1fpyh1:

Click to download the PDB-style file with coordinates for d1fpyh1.
(The format of our PDB-style files is described here.)

Timeline for d1fpyh1: