Lineage for d1fpyg2 (1fpy G:101-468)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196400Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 196401Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 196402Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 196403Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 196453Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 196486Domain d1fpyg2: 1fpy G:101-468 [59965]
    Other proteins in same PDB: d1fpya1, d1fpyb1, d1fpyc1, d1fpyd1, d1fpye1, d1fpyf1, d1fpyg1, d1fpyh1, d1fpyi1, d1fpyj1, d1fpyk1, d1fpyl1

Details for d1fpyg2

PDB Entry: 1fpy (more details), 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

SCOP Domain Sequences for d1fpyg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpyg2 d.128.1.1 (G:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOP Domain Coordinates for d1fpyg2:

Click to download the PDB-style file with coordinates for d1fpyg2.
(The format of our PDB-style files is described here.)

Timeline for d1fpyg2: