Lineage for d1fpye1 (1fpy E:1-100)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78215Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 78216Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 78217Protein Glutamine synthetase, N-terminal domain [54370] (1 species)
  7. 78218Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 78249Domain d1fpye1: 1fpy E:1-100 [59960]
    Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2

Details for d1fpye1

PDB Entry: 1fpy (more details), 2.89 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin

SCOP Domain Sequences for d1fpye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpye1 d.15.9.1 (E:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1fpye1:

Click to download the PDB-style file with coordinates for d1fpye1.
(The format of our PDB-style files is described here.)

Timeline for d1fpye1: