![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) ![]() |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
![]() | Domain d1fpye1: 1fpy E:1-100 [59960] Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2 |
PDB Entry: 1fpy (more details), 2.89 Å
SCOP Domain Sequences for d1fpye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpye1 d.15.9.1 (E:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d1fpye1: