Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) |
Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
Domain d1fpyb1: 1fpy B:1-100 [59954] Other proteins in same PDB: d1fpya2, d1fpyb2, d1fpyc2, d1fpyd2, d1fpye2, d1fpyf2, d1fpyg2, d1fpyh2, d1fpyi2, d1fpyj2, d1fpyk2, d1fpyl2 |
PDB Entry: 1fpy (more details), 2.89 Å
SCOP Domain Sequences for d1fpyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpyb1 d.15.9.1 (B:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d1fpyb1: