SCOP 1.57: Domain d1fpxa1: 1fpx A:8-108

Lineage for d1fpxa1 (1fpx A:8-108)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (2 proteins)

6. Protein Isoflavone O-methyltransferase [63478] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [63479] (2 PDB entries)

8. Domain d1fpxa1: 1fpx A:8-108 [59950]
   Other proteins in same PDB: d1fpxa2

Details for d1fpxa1

PDB Entry: 1fpx, 1.65 Å

PDB Description: crystal structure analysis of selenomethionine substituted isoflavone o-methyltransferase

SCOP Domain Sequences for d1fpxa1:

Sequence; same for both SEQRES and ATOM records:

>d1fpxa1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa)}
rkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsilqvpssk
ignvrrlmrylahngffeiitkeeesyaltvasellvrgsd

Timeline for d1fpxa1:

• d1fpxa1 is new in SCOP 1.57
  
• d1fpxa1 appears in SCOP 1.59
  
• d1fpxa1 last appears in SCOPe 2.07