Lineage for d1fpra_ (1fpr A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70682Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 70683Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 70708Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 70719Protein Tyrosine phosphatase [52806] (7 species)
  7. 70751Species Human (Homo sapiens), shp-1 [TaxId:9606] [52811] (2 PDB entries)
  8. 70752Domain d1fpra_: 1fpr A: [59949]

Details for d1fpra_

PDB Entry: 1fpr (more details), 2.5 Å

PDB Description: crystal structure of the complex formed between the catalytic domain of shp-1 and an in vitro peptide substrate py469 derived from shps-1.

SCOP Domain Sequences for d1fpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1}
gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi
diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevl

SCOP Domain Coordinates for d1fpra_:

Click to download the PDB-style file with coordinates for d1fpra_.
(The format of our PDB-style files is described here.)

Timeline for d1fpra_: