![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) ![]() |
![]() | Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) |
![]() | Protein Tyrosine phosphatase [52806] (7 species) |
![]() | Species Human (Homo sapiens), shp-1 [TaxId:9606] [52811] (2 PDB entries) |
![]() | Domain d1fpra_: 1fpr A: [59949] |
PDB Entry: 1fpr (more details), 2.5 Å
SCOP Domain Sequences for d1fpra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1} gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevl
Timeline for d1fpra_: