Lineage for d1fp1d2 (1fp1 D:129-372)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129522Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 protein domains)
    automatically mapped to Pfam PF00891
  6. 2129551Protein Chalcone O-methyltransferase [64112] (1 species)
  7. 2129552Species Alfalfa (Medicago sativa) [TaxId:3879] [64113] (2 PDB entries)
  8. 2129553Domain d1fp1d2: 1fp1 D:129-372 [59940]
    Other proteins in same PDB: d1fp1d1
    complexed with hcc, sah

Details for d1fp1d2

PDB Entry: 1fp1 (more details), 1.82 Å

PDB Description: crystal structure analysis of chalcone o-methyltransferase
PDB Compounds: (D:) isoliquiritigenin 2'-o-methyltransferase

SCOPe Domain Sequences for d1fp1d2:

Sequence, based on SEQRES records: (download)

>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
rgylasfttflcypallqvwmnfkeavvdedidlfknvhgvtkyefmgkdkkmnqifnks
mvdvcatemkrmleiytgfegistlvdvgggsgrnleliiskyplikginfdlpqviena
pplsgiehvggdmfasvpqgdamilkavchnwsdekcieflsnchkalspngkviivefi
lpeepntseesklvstldnlmfitvggrertekqyeklsklsgfskfqvacrafnslgvm
efyk

Sequence, based on observed residues (ATOM records): (download)

>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
rgylasfttflcypallqvwmnfkeavvdedfmgkdkkmnqifnksmvdvcatemkrmle
iytgfegistlvdvgggsgrnleliiskyplikginfdlpqvienapplsgiehvggdmf
asvpqgdamilkavchnwsdekcieflsnchkalspngkviivefilpeepntseesklv
stldnlmfitvggrertekqyeklsklsgfskfqvacrafnslgvmefyk

SCOPe Domain Coordinates for d1fp1d2:

Click to download the PDB-style file with coordinates for d1fp1d2.
(The format of our PDB-style files is described here.)

Timeline for d1fp1d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fp1d1