| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins) unknown function |
| Protein Chalcone O-methyltransferase [63476] (1 species) |
| Species Alfalfa (Medicago sativa) [TaxId:3879] [63477] (2 PDB entries) |
| Domain d1fp1d1: 1fp1 D:19-128 [59939] Other proteins in same PDB: d1fp1d2 complexed with hcc, sah |
PDB Entry: 1fp1 (more details), 1.82 Å
SCOP Domain Sequences for d1fp1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa)}
qtedsaclsamvlttnlvypavlnaaidlnlfeiiakatppgafmspseiasklpastqh
sdlpnrldrmlrllasysvltsttrtiedggaervyglsmvgkylvpdes
Timeline for d1fp1d1: