SCOP 1.65: Domain d1fopa_: 1fop A:

Lineage for d1fopa_ (1fop A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (30 PDB entries)

8. Domain d1fopa_: 1fop A: [59936]

Details for d1fopa_

PDB Entry: 1fop, 2.3 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with l-arg and no(h4b-bound)

SCOP Domain Sequences for d1fopa_:

Sequence; same for both SEQRES and ATOM records:

>d1fopa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1fopa_:

• d1fopa_ first appeared in SCOP 1.57
  
• d1fopa_ appears in SCOP 1.63
  
• d1fopa_ appears in SCOP 1.67
  
• d1fopa_ appears in the current release, SCOPe 2.08