Lineage for d1fooa_ (1foo A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738598Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 738599Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 738600Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 738601Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 738607Species Cow (Bos taurus) [TaxId:9913] [56517] (39 PDB entries)
  8. 738642Domain d1fooa_: 1foo A: [59934]

Details for d1fooa_

PDB Entry: 1foo (more details), 2 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with l-arg and no(h4b-free)
PDB Compounds: (A:) Nitric-oxide synthase

SCOP Domain Sequences for d1fooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fooa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOP Domain Coordinates for d1fooa_:

Click to download the PDB-style file with coordinates for d1fooa_.
(The format of our PDB-style files is described here.)

Timeline for d1fooa_: