SCOPe 2.08: Domain d1folb_: 1fol B:

Lineage for d1folb_ (1fol B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
   Uniprot P29473 67-482

8. Domain d1folb_: 1fol B: [59933]
   complexed with act, arg, cac, gol, hem, zn

Details for d1folb_

PDB Entry: 1fol, 2.2 Å

PDB Description: reduced bovine endothelial nitric oxide synthase heme domain complexed with l-arg(h4b-free)

PDB Compounds: (B:) Nitric-oxide synthase

SCOPe Domain Sequences for d1folb_:

Sequence; same for both SEQRES and ATOM records:

>d1folb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1folb_:

• d1folb_ first appeared in SCOP 1.57
  
• d1folb_ appears in SCOPe 2.07