Lineage for d1fola_ (1fol A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3003151Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 3003159Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
    Uniprot P29473 67-482
  8. 3003218Domain d1fola_: 1fol A: [59932]
    complexed with act, arg, cac, gol, hem, zn

Details for d1fola_

PDB Entry: 1fol (more details), 2.2 Å

PDB Description: reduced bovine endothelial nitric oxide synthase heme domain complexed with l-arg(h4b-free)
PDB Compounds: (A:) Nitric-oxide synthase

SCOPe Domain Sequences for d1fola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fola_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1fola_:

Click to download the PDB-style file with coordinates for d1fola_.
(The format of our PDB-style files is described here.)

Timeline for d1fola_: