SCOP 1.75: Domain d1foia_: 1foi A:

Lineage for d1foia_ (1foi A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (40 PDB entries)
   Uniprot P29473 67-482

8. Domain d1foia_: 1foi A: [59930]

Details for d1foia_

PDB Entry: 1foi, 1.93 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 1400w(h4b-free)

PDB Compounds: (A:) Nitric-oxide synthase

SCOP Domain Sequences for d1foia_:

Sequence; same for both SEQRES and ATOM records:

>d1foia_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1foia_:

• d1foia_ first appeared in SCOP 1.57
  
• d1foia_ appears in SCOP 1.73
  
• d1foia_ appears in SCOPe 2.01
  
• d1foia_ appears in the current release, SCOPe 2.08