Lineage for d1foaa_ (1foa A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400342Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 400343Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 400562Family c.68.1.10: N-acetylglucosaminyltransferase I [64136] (1 protein)
  6. 400563Protein N-acetylglucosaminyltransferase I [64137] (1 species)
  7. 400564Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [64138] (3 PDB entries)
  8. 400567Domain d1foaa_: 1foa A: [59929]
    complexed with gol, mn, ud1

Details for d1foaa_

PDB Entry: 1foa (more details), 1.8 Å

PDB Description: crystal structure of n-acetylglucosaminyltransferase i

SCOP Domain Sequences for d1foaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foaa_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus)}
avipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavthir
qpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffeyfq
atypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelepkw
pkafwddwmrrpeqrkgracvrpeisrtmtfgrkgvshgqffdqhlkfiklnqqfvpftq
ldlsylqqeaydrdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalgv
mddlksgvpragyrgivtflfrgrrvhlappqtwdgydpswt

SCOP Domain Coordinates for d1foaa_:

Click to download the PDB-style file with coordinates for d1foaa_.
(The format of our PDB-style files is described here.)

Timeline for d1foaa_: