Lineage for d1fo9a_ (1fo9 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73507Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 73508Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 73625Family c.68.1.10: N-acetylglucosaminyltransferase I [64136] (1 protein)
  6. 73626Protein N-acetylglucosaminyltransferase I [64137] (1 species)
  7. 73627Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [64138] (3 PDB entries)
  8. 73629Domain d1fo9a_: 1fo9 A: [59928]

Details for d1fo9a_

PDB Entry: 1fo9 (more details), 1.5 Å

PDB Description: crystal structure of n-acetylglucosaminyltransferase i

SCOP Domain Sequences for d1fo9a_:

Sequence, based on SEQRES records: (download)

>d1fo9a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus)}
elavipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavth
irqpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffey
fqatypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelep
kwpkafwddwmrrpeqrkgracvrpeisrtmtfgrkgvshgqffdqhlkfiklnqqfvpf
tqldlsylqqeaydrdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakal
gvmddlksgvpragyrgivtflfrgrrvhlappqtwdgydpswt

Sequence, based on observed residues (ATOM records): (download)

>d1fo9a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus)}
elavipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavth
irqpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffey
fqatypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelep
kwpkafwddwmrrpeqrkgracvrpeisrtmtfglkfiklnqqfvpftqldlsylqqeay
drdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalgvmddlksgvpra
gyrgivtflfrgrrvhlappqtwdgydpswt

SCOP Domain Coordinates for d1fo9a_:

Click to download the PDB-style file with coordinates for d1fo9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fo9a_: