Lineage for d1fo9a1 (1fo9 A:106-447)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133669Family c.68.1.10: N-acetylglucosaminyltransferase I [64136] (2 protein domains)
    automatically mapped to Pfam PF03071
  6. 2133670Protein N-acetylglucosaminyltransferase I [64137] (1 species)
  7. 2133671Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [64138] (3 PDB entries)
  8. 2133673Domain d1fo9a1: 1fo9 A:106-447 [59928]
    Other proteins in same PDB: d1fo9a2

Details for d1fo9a1

PDB Entry: 1fo9 (more details), 1.5 Å

PDB Description: crystal structure of n-acetylglucosaminyltransferase i
PDB Compounds: (A:) alpha-1,3-mannosyl-glycoprotein beta-1,2-n-acetylglucosaminyltransferase

SCOPe Domain Sequences for d1fo9a1:

Sequence, based on SEQRES records: (download)

>d1fo9a1 c.68.1.10 (A:106-447) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
avipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavthir
qpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffeyfq
atypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelepkw
pkafwddwmrrpeqrkgracvrpeisrtmtfgrkgvshgqffdqhlkfiklnqqfvpftq
ldlsylqqeaydrdflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalgv
mddlksgvpragyrgivtflfrgrrvhlappqtwdgydpswt

Sequence, based on observed residues (ATOM records): (download)

>d1fo9a1 c.68.1.10 (A:106-447) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
avipilviacdrstvrrcldkllhyrpsaelfpiivsqdcgheetaqviasygsavthir
qpdlsniavqpdhrkfqgyykiarhyrwalgqifhnfnypaavvveddlevapdffeyfq
atypllkadpslwcvsawndngkeqmvdsskpellyrtdffpglgwlllaelwaelepkw
pkafwddwmrrpeqrkgracvrpeisrtmtfglkfiklnqqfvpftqldlsylqqeaydr
dflarvygapqlqvekvrtndrkelgevrvqytgrdsfkafakalgvmddlksgvpragy
rgivtflfrgrrvhlappqtwdgydpswt

SCOPe Domain Coordinates for d1fo9a1:

Click to download the PDB-style file with coordinates for d1fo9a1.
(The format of our PDB-style files is described here.)

Timeline for d1fo9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fo9a2