Lineage for d1fnza_ (1fnz A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042365Species Black locust (Robinia pseudoacacia) [TaxId:35938] [63730] (2 PDB entries)
  8. 2042367Domain d1fnza_: 1fnz A: [59921]
    complexed with a2g, ca

Details for d1fnza_

PDB Entry: 1fnz (more details), 2.05 Å

PDB Description: A bark lectin from robinia pseudoacacia in complex with N-acetylgalactosamine
PDB Compounds: (A:) bark agglutinin I, polypeptide a

SCOPe Domain Sequences for d1fnza_:

Sequence, based on SEQRES records: (download)

>d1fnza_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]}
tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkdgyfnksnq
ivavefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltas
lvypsletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg

Sequence, based on observed residues (ATOM records): (download)

>d1fnza_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]}
tgslsfsfpkfapnqpylinqgdalvtstgvlqltnvvngvpsskslgralyaapfqiwd
sttgnvasfvtsftfiiqapnpattadglafflapvdtqpldlggmlgifkfnksnqiva
vefdtfsngdwdpkgrhlginvnsiesiktvpwnwtngevanvfisyeastksltaslvy
psletsfiidaivdvkivlpewvrfgfsattgidkgyvqtndvlswsfesnlpg

SCOPe Domain Coordinates for d1fnza_:

Click to download the PDB-style file with coordinates for d1fnza_.
(The format of our PDB-style files is described here.)

Timeline for d1fnza_: