SCOP 1.61: Domain d1fnqm1: 1fnq M:

Lineage for d1fnqm1 (1fnq M:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries)

8. Domain d1fnqm1: 1fnq M: [59919]
   Other proteins in same PDB: d1fnqh1

Details for d1fnqm1

PDB Entry: 1fnq, 2.6 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> glu from the photosynthetic purple bacterium rhodobacter sphaeroides

SCOP Domain Sequences for d1fnqm1:

Sequence; same for both SEQRES and ATOM records:

>d1fnqm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1fnqm1:

• d1fnqm1 first appeared in SCOP 1.57
  
• d1fnqm1 appears in SCOP 1.59
  
• d1fnqm1 is called d1fnqm_ in SCOP 1.63
  
• d1fnqm1 appears in the current release, SCOPe 2.08, called d1fnqm_