Lineage for d1fnqm1 (1fnq M:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87638Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 87639Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 87640Species Rhodobacter sphaeroides [TaxId:1063] [56881] (23 PDB entries)
  8. 87685Domain d1fnqm1: 1fnq M: [59919]
    Other proteins in same PDB: d1fnqh1

Details for d1fnqm1

PDB Entry: 1fnq (more details), 2.6 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> glu from the photosynthetic purple bacterium rhodobacter sphaeroides

SCOP Domain Sequences for d1fnqm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnqm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOP Domain Coordinates for d1fnqm1:

Click to download the PDB-style file with coordinates for d1fnqm1.
(The format of our PDB-style files is described here.)

Timeline for d1fnqm1: