| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein L (light) subunit [81477] (4 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries) Uniprot P02954 |
| Domain d1fnql_: 1fnq L: [59918] Other proteins in same PDB: d1fnqh1, d1fnqh2, d1fnqm_ complexed with bcl, bph, fe, lda, po4, spo, u10; mutant |
PDB Entry: 1fnq (more details), 2.6 Å
SCOPe Domain Sequences for d1fnql_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnql_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtedhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1fnql_: