Class b: All beta proteins [48724] (174 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein Photosynthetic reaction centre [50348] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries) Uniprot P11846 |
Domain d1fnqh1: 1fnq H:36-249 [59916] Other proteins in same PDB: d1fnqh2, d1fnql_, d1fnqm_ complexed with bcl, bph, fe, lda, po4, spo, u10; mutant |
PDB Entry: 1fnq (more details), 2.6 Å
SCOPe Domain Sequences for d1fnqh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnqh1 b.41.1.1 (H:36-249) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrk
Timeline for d1fnqh1: