![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
![]() | Protein Photosynthetic reaction centre [50348] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries) |
![]() | Domain d1fnph1: 1fnp H:36-250 [59912] Other proteins in same PDB: d1fnph2, d1fnpl_, d1fnpm_ complexed with bcl, bph, fe, lda, po4, spo, u10; mutant |
PDB Entry: 1fnp (more details), 2.6 Å
SCOP Domain Sequences for d1fnph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnph1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d1fnph1: