SCOPe 2.08: Domain d1fnph1: 1fnp H:36-250

Lineage for d1fnph1 (1fnp H:36-250)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d1fnph1: 1fnp H:36-250 [59912]
   Other proteins in same PDB: d1fnph2, d1fnpl_, d1fnpm_
   complexed with bcl, bph, fe, lda, po4, spo, u10; mutant

Details for d1fnph1

PDB Entry: 1fnp, 2.6 Å

PDB Description: crystal structure analysis of the mutant reaction center pro l209-> phe from the photosynthetic purple bacterium rhodobacter sphaeroides

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1fnph1:

Sequence; same for both SEQRES and ATOM records:

>d1fnph1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1fnph1:

• d1fnph1 first appeared in SCOP 1.57
  
• d1fnph1 appears in SCOPe 2.07