Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries) probably orthologous to the human HLA-DR group |
Domain d1fngd1: 1fng D:93-188 [59910] Other proteins in same PDB: d1fnga1, d1fnga2, d1fngb2, d1fngc1, d1fngc2, d1fngd2 contains covalently bound peptides at the N-termini of chains B and D complexed with nag |
PDB Entry: 1fng (more details), 1.9 Å
SCOP Domain Sequences for d1fngd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fngd1 b.1.1.2 (D:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group} rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd wtfqtlvmletvpqsgevytcqvehpsltdpvtvew
Timeline for d1fngd1: