SCOPe 2.02: Domain d1fnga1: 1fng A:82-182

Lineage for d1fnga1 (1fng A:82-182)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
probably orthologous to the human HLA-DR group
Domain d1fnga1: 1fng A:82-182 [59904]
Other proteins in same PDB: d1fnga2, d1fngb1, d1fngb2, d1fngc2, d1fngd1, d1fngd2
complexed with nag

Details for d1fnga1

PDB Entry: 1fng (more details), 1.9 Å

PDB Description: histocompatibility antigen

PDB Compounds: (A:) protein (MHC class II I-ek, alpha chain)

SCOPe Domain Sequences for d1fnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOPe Domain Coordinates for d1fnga1:

Click to download the PDB-style file with coordinates for d1fnga1.
(The format of our PDB-style files is described here.)

Timeline for d1fnga1: