SCOP 1.73: Domain d1fned1: 1fne D:93-188

Lineage for d1fned1 (1fne D:93-188)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1fned1: 1fne D:93-188 [59902]
   Other proteins in same PDB: d1fnea1, d1fnea2, d1fneb2, d1fnec1, d1fnec2, d1fned2
   contains covalently bound peptides at the N-termini of chains B and D
   complexed with nag; mutant

Details for d1fned1

PDB Entry: 1fne, 1.9 Å

PDB Description: histocompatibility antigen

PDB Compounds: (D:) protein (MHC class II I-ek, beta chain)

SCOP Domain Sequences for d1fned1:

Sequence; same for both SEQRES and ATOM records:

>d1fned1 b.1.1.2 (D:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

Timeline for d1fned1:

• d1fned1 first appeared in SCOP 1.57
  
• d1fned1 appears in SCOP 1.71
  
• d1fned1 appears in SCOP 1.75
  
• d1fned1 appears in the current release, SCOPe 2.08