SCOP 1.75: Domain d1fneb2: 1fne B:4-92

Lineage for d1fneb2 (1fne B:4-92)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)

8. Domain d1fneb2: 1fne B:4-92 [59899]
   Other proteins in same PDB: d1fnea1, d1fnea2, d1fneb1, d1fnec1, d1fnec2, d1fned1
   contains covalently bound peptides at the N-termini of chains B and D

Details for d1fneb2

PDB Entry: 1fne, 1.9 Å

PDB Description: histocompatibility antigen

PDB Compounds: (B:) protein (MHC class II I-ek, beta chain)

SCOP Domain Sequences for d1fneb2:

Sequence; same for both SEQRES and ATOM records:

>d1fneb2 d.19.1.1 (B:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

Timeline for d1fneb2:

• d1fneb2 first appeared in SCOP 1.57
  
• d1fneb2 appears in SCOP 1.73
  
• d1fneb2 appears in SCOPe 2.01
  
• d1fneb2 appears in the current release, SCOPe 2.08