Lineage for d1fneb2 (1fne B:4-92)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255507Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries)
  8. 255513Domain d1fneb2: 1fne B:4-92 [59899]
    Other proteins in same PDB: d1fnea1, d1fneb1, d1fnec1, d1fned1

Details for d1fneb2

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fneb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fneb2 d.19.1.1 (B:4-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOP Domain Coordinates for d1fneb2:

Click to download the PDB-style file with coordinates for d1fneb2.
(The format of our PDB-style files is described here.)

Timeline for d1fneb2: