Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries) |
Domain d1fn4d2: 1fn4 D:107-208 [59891] Other proteins in same PDB: d1fn4a1, d1fn4a2, d1fn4b1, d1fn4c1, d1fn4c2, d1fn4d1 part of Fab 198 against acetylcholine receptor |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOPe Domain Sequences for d1fn4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4d2 b.1.1.2 (D:107-208) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]} tmvtvssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg lytltssvtvpsstwssqavtcnvahpasstkvdkkivprdc
Timeline for d1fn4d2: