| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (4 PDB entries) |
| Domain d1fn4d2: 1fn4 D:107-208 [59891] Other proteins in same PDB: d1fn4a1, d1fn4a2, d1fn4b1, d1fn4c1, d1fn4c2, d1fn4d1 part of Fab 198 against acetylcholine receptor |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOP Domain Sequences for d1fn4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4d2 b.1.1.2 (D:107-208) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus)}
tmvtvssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg
lytltssvtvpsstwssqavtcnvahpasstkvdkkivprdc
Timeline for d1fn4d2: