Lineage for d1fn4d2 (1fn4 D:107-208)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365520Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (4 PDB entries)
  8. 365530Domain d1fn4d2: 1fn4 D:107-208 [59891]
    Other proteins in same PDB: d1fn4a1, d1fn4a2, d1fn4b1, d1fn4c1, d1fn4c2, d1fn4d1
    part of Fab 198 against acetylcholine receptor

Details for d1fn4d2

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4d2 b.1.1.2 (D:107-208) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus)}
tmvtvssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg
lytltssvtvpsstwssqavtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1fn4d2:

Click to download the PDB-style file with coordinates for d1fn4d2.
(The format of our PDB-style files is described here.)

Timeline for d1fn4d2: