Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab 198 against actylcholine receptor, (rat) [63659] (1 PDB entry) |
Domain d1fn4d2: 1fn4 D:107-208 [59891] Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4c1, d1fn4d1 |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOP Domain Sequences for d1fn4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4d2 b.1.1.2 (D:107-208) Immunoglobulin (constant domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)} tmvtvssvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg lytltssvtvpsstwssqavtcnvahpasstkvdkkivprdc
Timeline for d1fn4d2: