Lineage for d1fn4d1 (1fn4 D:1-106)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219412Species Fab 198 against actylcholine receptor, (rat) [63648] (1 PDB entry)
  8. 219416Domain d1fn4d1: 1fn4 D:1-106 [59890]
    Other proteins in same PDB: d1fn4a2, d1fn4b2, d1fn4c2, d1fn4d2

Details for d1fn4d1

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4d1 b.1.1.1 (D:1-106) Immunoglobulin (variable domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)}
qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpg

SCOP Domain Coordinates for d1fn4d1:

Click to download the PDB-style file with coordinates for d1fn4d1.
(The format of our PDB-style files is described here.)

Timeline for d1fn4d1: