Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab 198 against actylcholine receptor, (rat) [63648] (1 PDB entry) |
Domain d1fn4d1: 1fn4 D:1-106 [59890] Other proteins in same PDB: d1fn4a2, d1fn4b2, d1fn4c2, d1fn4d2 |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOP Domain Sequences for d1fn4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4d1 b.1.1.1 (D:1-106) Immunoglobulin (variable domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)} qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpg
Timeline for d1fn4d1: