SCOP 1.57: Domain d1fn4d1: 1fn4 D:1-106

Lineage for d1fn4d1 (1fn4 D:1-106)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 198 against actylcholine receptor, (rat) [63648] (1 PDB entry)

8. Domain d1fn4d1: 1fn4 D:1-106 [59890]
   Other proteins in same PDB: d1fn4a2, d1fn4b2, d1fn4c2, d1fn4d2

Details for d1fn4d1

PDB Entry: 1fn4, 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4d1:

Sequence; same for both SEQRES and ATOM records:

>d1fn4d1 b.1.1.1 (D:1-106) Immunoglobulin (variable domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)}
qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpg

Timeline for d1fn4d1:

• d1fn4d1 is new in SCOP 1.57
  
• d1fn4d1 appears in SCOP 1.59
  
• d1fn4d1 appears in the current release, SCOPe 2.08