Lineage for d1fn4c2 (1fn4 C:108-211)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786696Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (6 PDB entries)
  8. 786710Domain d1fn4c2: 1fn4 C:108-211 [59889]
    Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4b2, d1fn4c1, d1fn4d1, d1fn4d2
    part of Fab 198 against acetylcholine receptor

Details for d1fn4c2

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
PDB Compounds: (C:) monoclonal antibody against acetylcholine receptor

SCOP Domain Sequences for d1fn4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4c2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd
stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

SCOP Domain Coordinates for d1fn4c2:

Click to download the PDB-style file with coordinates for d1fn4c2.
(The format of our PDB-style files is described here.)

Timeline for d1fn4c2: