![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries) |
![]() | Domain d1fn4c2: 1fn4 C:108-211 [59889] Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4b2, d1fn4c1, d1fn4d1, d1fn4d2 part of Fab 198 against acetylcholine receptor |
PDB Entry: 1fn4 (more details), 2.8 Å
SCOP Domain Sequences for d1fn4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn4c2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)} taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec
Timeline for d1fn4c2: