SCOP 1.65: Domain d1fn4c2: 1fn4 C:108-211

Lineage for d1fn4c2 (1fn4 C:108-211)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries)

8. Domain d1fn4c2: 1fn4 C:108-211 [59889]
   Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4b2, d1fn4c1, d1fn4d1, d1fn4d2
   part of Fab 198 against acetylcholine receptor

Details for d1fn4c2

PDB Entry: 1fn4, 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4c2:

Sequence; same for both SEQRES and ATOM records:

>d1fn4c2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)}
taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd
stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

Timeline for d1fn4c2:

• d1fn4c2 first appeared in SCOP 1.57
  
• d1fn4c2 appears in SCOP 1.63
  
• d1fn4c2 appears in SCOP 1.67
  
• d1fn4c2 appears in the current release, SCOPe 2.08