Lineage for d1fn4a2 (1fn4 A:108-211)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221216Species Fab 198 against actylcholine receptor, (rat) [63659] (1 PDB entry)
  8. 221217Domain d1fn4a2: 1fn4 A:108-211 [59885]
    Other proteins in same PDB: d1fn4a1, d1fn4b1, d1fn4c1, d1fn4d1

Details for d1fn4a2

PDB Entry: 1fn4 (more details), 2.8 Å

PDB Description: crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies

SCOP Domain Sequences for d1fn4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn4a2 b.1.1.2 (A:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 198 against actylcholine receptor, (rat)}
taptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskd
stysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

SCOP Domain Coordinates for d1fn4a2:

Click to download the PDB-style file with coordinates for d1fn4a2.
(The format of our PDB-style files is described here.)

Timeline for d1fn4a2: